PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla013668
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family MYB
Protein Properties Length: 554aa    MW: 61217.9 Da    PI: 5.2352
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla013668genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53.1e-183885148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ede+l+++vk +G g+W+++ ++ g+ R++k+c++rw ++l
        Cla013668 38 KGPWTSAEDEILIEYVKNHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 85
                     79******************************************9986 PP

2Myb_DNA-binding52.11.5e-1691134146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ l++++++++G++ W++ a++++ gRt++++k++w++
        Cla013668  91 KGAFTAEEEHLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 134
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0383385IPR017930Myb domain
SuperFamilySSF466892.1E-3037132IPR009057Homeodomain-like
SMARTSM007171.2E-153787IPR001005SANT/Myb domain
PfamPF002494.2E-163885IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-243992IPR009057Homeodomain-like
CDDcd001671.02E-114085No hitNo description
PROSITE profilePS5129426.0686140IPR017930Myb domain
SMARTSM007171.1E-1590138IPR001005SANT/Myb domain
PfamPF002491.4E-1591134IPR001005SANT/Myb domain
CDDcd001672.65E-1193134No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2593139IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 554 aa     Download sequence    Send to blast
MRHPKNEIED SIPSKDQILS PLVDEDSGGN ASGVVLKKGP WTSAEDEILI EYVKNHGEGN  60
WNAVQKHSGL SRCGKSCRLR WANHLRPNLK KGAFTAEEEH LIIELHAKMG NKWARMAAHL  120
PGRTDNEIKN YWNTRIKRRQ RAGLPLYPPE VCLRTWQALQ QTQDTGGSNI VDKDHHDLLR  180
TNSYDIPDVT FHSLKPQSAL SYMPELPDIS SCMLKRGLDS SQYCNFMQST MHRQKRFRES  240
ASLFPGPDGS VKTPFHQFED NSYSQVAQSY GSAFPLESNP TTKNAMSFGS FEGSHSLTNG  300
NSSASQHSKE TEKLELPSLQ YPETDLSSWD TPIQPAMFEP VDPFIQSPPT FMLGSDCPSP  360
RHSGLLEALI YESKTMGCPK NHPSDKNSNS CSVTPGDVTD SYNMAGSKTE IDDYTEAISP  420
FGHSTSSLFS ECTPISATGS SYEDPTLTEA FSGSIVKSEP LDHAWTPDRE KAAKNGVEFT  480
RPDALLASDW QDRSSGIVED TTNVTDAISL LLGDDLAADY EHLPTGISTA HLGWGLDSCS  540
WNNMPAVCHM SDLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31361395107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818210.0LN681821.1 Cucumis melo genomic scaffold, anchoredscaffold00040.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008456639.10.0PREDICTED: transcription factor GAMYB
RefseqXP_008456638.10.0PREDICTED: transcription factor GAMYB
TrEMBLM5X3T10.0M5X3T1_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01630.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-124myb domain protein 33